paulo (she/they)
Install Theme

kitkatastrophe:

dvandom:

akawaru:

If u haven’t cried in a math class you’re not allowed to follow me. Mathematical illiterates on this blog ONLY

You don’t need to be mathematically illiterate to cry in math class.  You just keep taking higher and higher math until you cry.

image

(via lizardbuzz)

imaginedsoldier:

This guy at my office is talking about how some ~20 unionized workers that operate bridges shut down a huge chunk of the city by lifting the bridges then leaving on a boat until their demands were met and I forgot I was supposed to say “oh that’s fucked up” because I was immediately like sick that’s dope as hell lmao

Think about how much power labor has. These guys working in big positions talking about the kind of damage some “high school dropouts who ganged up” can do with an edge of fear in their voice

Like sorry you got punked out by these guys you think are below you bitchboy you dont sound very in charge lmao

(via ricketybonez)

siderealsandman:

shiredded:

pumpfatandkittenheels:

What’s worse than evil?

sailorbluemoon:

Holy fuck the original is worse

ruudiinn:

^ thats the original image, in case you want to see exactly how fucking vile these bastards are.

(those are signs they confiscated from homeless people they arrested for “panhandling” during the holiday season)

atomicwinterlove:

image

softwaring:

image

This is true and this is vile. 

Now what would happen if a homeless quilt was made by someone who actually cared about homeless people?

Meet former ad designer Willie Baronet. 

image

Baronet is an artist who talks to homeless people and buys their signs from them for $20 a pop, if they’re willing to sell. He uses the signs in art exhibits to educate the privileged and point them to ways they can help, and to humanize homeless people and tell them they matter. 

One sign at a time, Baronet makes a statement to help people with $20 in their hand and a voice that rings across the nation saying “I’m here.”

(source)

So not only did they take the small, hand-made signs away from homeless people but instead of just tossing them, they kept them. Not only did they keep them as some kind of homeless trophy, they actually went through the time, energy, and effort (funded by tax dollars) to tape them together, pose for a picture, and post it during the holiday season. 

This is why people say that there are no good cops. Because there aren’t. 

(via cikero)

cubonetears-deactivated20220426:

i simply do not vibe with the concept of having to give human hours of my life in exchange for the necessities of living

(via ricketybonez)

hunterinabrowncoat:

I feel like it’s time we talked about how there is no such thing as universal accessibility. One space cannot be accessible for every single person. And I don’t say that to suggest that we just shouldn’t try making spaces as accessible as possible, but rather to say how important it is that we have multiple, different spaces.

A place that is well-lit and has lots of natural light will help many visually impaired people, but it will be a nightmare for anyone with photo-sensitivity. A small, dimly lit, quiet space might be ideal for somebody with sensory overload, but not for somebody with claustrophobia. A solarpunk utopia where the cities are filled with plants and trees and green might massively help the population’s depression and general spirits, but it would be hell for anyone with autoimmune disorders and allergies.

At the LGBTQ+ Christian group I go to, there are some really flamboyant, loud, and excitable extroverts there, who love to sing their hearts out and clap and dance during worship. There are also people who have sensory issues and anxiety exacerbated by loud noise. It cannot be a safe-space for everyone to express themselves freely, if it’s also a safe space for those with anxiety.

In a learning environment, one child with ADHD may need to bounce their leg or fidget with something in order to concentrate, while another autistic child finds that incredibly distracting and makes them anxious.

A small, tight, cosy space that’s reminiscent of a village pub or small cottage might be ideal for making me feel comfortable, sheltered and reducing my anxiety and social exhaustion, but it wouldn’t be very accessible for a wheelchair user or someone with physical mobility issues. I am both of those people.

Nobody is doing anything wrong, nobody is being victimised by another person, there’s no right and wrong in these situations. It’s just that those people have opposing needs that can’t be accommodated in the same space at the same time. And we need to talk about that.

What’s important is that we create different spaces to cater to a multitude of needs, and that we listen to people’s needs. Most importantly we need to look at which groups of people and which needs are often ignored, and which people have very little access to spaces.

(via ricketybonez)

spelldealer:

your 20’s are all about finding THE wackiest, THE ugliest, short-sleeve button-up shirts that no one in their right mind would wear, and then wearing them as much as possible

(via ricketybonez)

dirtgirl1999:

being an adult is just… calling people that’s literally it… just calling people you don’t want to call about problems you don’t want to have to be solving.. it’s disgusting

(via ricketybonez)

niacinamides-deactivated2020010:

niacinamides-deactivated2020010:

LGBTDYSAMYLSDYERYVAMIAYMDYUAIDIWASADYAAIGBITFFOYFSFODARAASAWNYSIDAIKYMHAIKIWAAAIKYIPAIWICTTAFYIWICSYFTKTYDWYDBYSIDAWAWIICHMBUTOSIYCHJSISOFUTWHMTWCDSWTBYCTRFASNICAAICFBNAATD!

Lesbian Gay Bi Trans don’t you swear at me, you little shit! Don’t you ever raise your voice at me! I am your mother! Do you understand? All I do is worry and slave and defend you. And all I get back is that fucking face on your face. So full of disdain and resentment and always so annoyed. Well, now your sister is dead. And I know you miss her, and I know it was an accident and I know you’re in pain. And I wish I could take that away for you. I wish I could shield you from the knowledge that you did what you did, but your sister is dead! She’s gone forever! And what a waste. If it could have maybe brought us together or something. If you could have just said, ‘I’m sorry’, or faced up to what happened. Maybe then we could do something with this. But you can’t take responsibility for anything! So now I can’t accept… And I can’t forgive because… Because nobody admits anything they’ve done!

(via 6937529469274696869-deactivated)

mikkeneko:

pineapplesquid:

pineapplesquid:

copperbadge:

botanyshitposts:

one of the most important things ive learned from upper level biology education so far is that dna isnt the god-like all-powerful beacon of similarity between all living beings on the face of the earth as high school science textbooks will lead u to believe but actually is, in fact, the molecular equivalent of a smoldering dumpster fire that’s in a constant state of chaos and cellular scandal like some highlights: 

-the parts of dna that just casually detach on a physical level from the main strand, do some sick skateboard tricks in the cytoplasm, and land somewhere else with 43552342 copies

-the parts that would do A Thing if they wern’t physically spooled up so tightly that the Make Thing Happen machinery couldnt get to them

-the dna thats in ur mitochondria bc the mitochondria used to be a bacteria that our bigger, buffer cellular ancestors just vored in the primordial ooze 

-the dna that’s in chloroplasts in plants for the same reason

-rna….bitches be crazy like what is she gonna do next?? o she gonna act like a protein now and do shit?? im on the edge of my seat 

-sometimes u just gotta make more chromosomes man like sometimes u just be hanging out and u gotta make ur genome 64 sizes larger and then change ur mind only 100,000 years later and delete half of it and thats just how it is on this bitch of an earth

-random shit from like 5 BCE is just casually left over everywhere like no susan i told u to leave that gene alone we might need it to fight dinosaurs again u just never know!!!!!

dna is earth’s biggest and brightest train wreck and honestly i wouldnt trust a dna molecule to water my plants let alone run my body but here we fucking are 

I am feeling physically very unstable after reading this. 

I’m a genetics professor and everything here is true.

There’s a fern that has 1,260 chromosomes. That’s 630 pairs of chromosomes. No, we don’t know why.

Oh, and everyone should know that the person who first presented evidence for endosymbiosis (the official name for cells eating each other and then turning into mitochondria or chloroplasts instead of being digested) was this woman, Lynn Margulis, in 1967: 

image

 Her paper where she presented the theory was rejected 15 times before it got published. Over the next decade, her work was mocked and ignored. Now every biologist knows that she was right.

The bits of DNA that move around (“jumping genes”) were discovered by this woman, Barbara McClintock, in the 1940′s: 

image

Her work on them was ignored and derided for about two decades before some people started to take it seriously. In 1983 she won a Nobel Prize for it.

Something of a derail, but I feel strongly about talking about the contributions of these two women.

it’s never not the time to learn about cool women in science

(via ricketybonez)

fuckyeahgreatplays:

Me, constantly

(via humorrelated)

letsallgotothelobby:

Silenced. 

(via cikero)

woolandcoffee:

aspiringwarriorlibrarian:

I’ve seen the Ursula K LeGuin quote about capitalism going around, but to really appreciate it you have to know the context.

The year is 2014. She has been given a lifetime achievement award from the National Book Awards. Neil Gaiman puts it on her neck in front of a crowd of booksellers who bankrolled the event, and it’s time to make a standard “thank you for this award, insert story here, something about diversity, blah blah blah” speech. She starts off doing just that, thanking her friends and fellow authors. All is well.

Then this old lady from Oregon looks her audience of executives dead in the eye, and says “Developing written material to suit sales strategies in order to maximize corporate profit and advertising revenue is not the same thing as responsible book publishing or authorship.”

She rails against the reduction of her art to a commodity produced only for profit. She denounces publishers who overcharge libraries for their products and censor writers in favor of something “more profitable”. She specifically denounces Amazon and its business practices, knowing full well that her audience is filled with Amazon employees. And to cap it off, she warns them: “We live in capitalism. Its power seems inescapable. So did the divine right of kings. Any human power can be resisted and changed by human beings. Resistance and change often begin in art. Very often in our art, the art of words.”

Ursula K LeGuin got up in front of an audience of some of the most powerful people in publishing, was expected to give a trite and politically safe argument about literature, and instead told them directly “Your empire will fall. And I will help it along.”

We stan an icon.

(via todayishappy)

funkpunkandroll84:

hundondestiny:

criminologyonthemind:

image
image
image
image

the Drake and Millie situation? why is this being allowed to happen. I know it happens all over the world but here - right in the public eye it’s happening and nobody is thinking anything of it??? Or are turning a blind fucking eye??

((Source

https://www.facebook.com/1885503711697761/posts/2146402772274519/ ))

Stop leaving out the Black girls.

image
image
image
image
image
image
image

Jorja is only just now 21 and Bella Harris is only 18.

And Drake was seeking Bella when she was 16.

image

Also I don’t like how some are like “well if this certain famous white boy ain’t getting called out for pedophilia, why should Drake?” STOP SAYING THAT. PLEASE STOP! You’re making yourself LOOK like a defender of the fuckshit Drake is doing…

(via todayishappy)

awed-frog:

“Capitalism does not permit an even flow of economic resources. With this system, a small privileged few are rich beyond conscience, and almost all others are doomed to be poor at some level. That’s the way the system works. And since we know that the system will not change the rules, we are going to have to change the system.” — Martin Luther King, Jr.

(via ricketybonez)

dyke-supreme:

Gonna be a rude dyke for a sec. So many straight women put their men (husbands, boyfriends, sons) above the safety and well-being of other women and it’s so fucking disheartening. How many straight mother stay quiet and are complicit in the violence their men put their daughters through? How many mothers have known their husband or boyfriend was molesting their daughter but put their head in the sand because it was easier, because this way they could keep him? I don’t have data but the number of survivor ive spoken to and the number of other survivors the ones I spoke to had also spoken to who all have similar stories can’t be a coincidence. The way straight women fight and fight and defend their men against anything that might ruin their good reputation. How much they hate when we point out their men’s creepy behaviors. I feel like it’s something we should talk about…

(via ricketybonez)